General Information

  • ID:  hor006193
  • Uniprot ID:  P33710
  • Protein name:  Galanin message-associated peptide
  • Gene name:  GAL
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Galanin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004966 galanin receptor activity; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031764 type 1 galanin receptor binding; GO:0031765 type 2 galanin receptor binding; GO:0031766 type 3 galanin receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045944 positive regulation of transcription by RNA polymerase II
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ELPPEDEGRSGGFAGPLSLSENAAV
  • Length:  25(30-54)
  • Propeptide:  LNSAGYLLGPHAIDNHRSFHEKPGLTGKRELPPEDEGRSGGFAGPLSLSENAAV
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endocrine hormone of the central and peripheral nervous systems that binds and activates the G protein-coupled receptors GALR1, GALR2, and GALR3. This small neuropeptide may regulate diverse physiologic functions including contraction of smooth muscle of
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P33710-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006193_AF2.pdbhor006193_ESM.pdb

Physical Information

Mass: 292793 Formula: C107H167N29O40
Absent amino acids: CHIKMQTWY Common amino acids: EG
pI: 3.67 Basic residues: 1
Polar residues: 8 Hydrophobic residues: 8
Hydrophobicity: -42 Boman Index: -3675
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 70.4
Instability Index: 6988 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  7512738
  • Title:  Canine galanin: sequence, expression and pancreatic effects.